DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33796

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027128.1 Gene:CG33796 / 3771914 FlyBaseID:FBgn0053796 Length:179 Species:Drosophila melanogaster


Alignment Length:148 Identity:47/148 - (31%)
Similarity:81/148 - (54%) Gaps:7/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 FQLQNVICESFDNAITNFSRCEMKFIRRGVAAF-YMVWKLYNVPIKSVDINVALYKKSNGYRPFL 86
            |:|.||.|.|::......::|.:|.|.|....| :....||  |.||:.::...:|:.|||||:|
  Fly    27 FKLTNVHCGSYNKTWIRINQCRLKAINRHRTVFNFNATFLY--PTKSITVHYQTFKRENGYRPWL 89

  Fly    87 FNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIYKKNDLKDLPIPNGDY 151
            .|..:|.|.::|.| ...|..::..::...:||||:||...|:|:.. :|...|:..||:|.|||
  Fly    90 VNTQIDGCRFLRKP-YDALGILLFNIYRNFTNINHTCPLQGDMIVRN-MYLTTDVMRLPLPTGDY 152

  Fly   152 MIRVKVAF--DKEYRTSI 167
            ::.:...|  ..::.|::
  Fly   153 LLAIDWIFYGKPQFATNV 170

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 29/81 (36%)
CG33796NP_001027128.1 DUF1091 74..154 CDD:284008 29/81 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472509
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
54.940

Return to query results.
Submit another query.