DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33689

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001027132.2 Gene:CG33689 / 3771798 FlyBaseID:FBgn0053689 Length:178 Species:Drosophila melanogaster


Alignment Length:152 Identity:50/152 - (32%)
Similarity:86/152 - (56%) Gaps:4/152 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 NVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSVDINVALYKKSNGYRPFLFNQTL 91
            |:.|.|.|.....|.:|.:|.:.|......:...||.:||.::.|:..|.:..:||:||..:.|.
  Fly    25 NIKCGSKDPTFAIFKKCFIKAVNRTHKYVDVYVNLYKLPIDNITISFRLMRHDHGYKPFFIDYTF 89

  Fly    92 DFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEF---IYKKNDLKDLPIPNGDYMI 153
            |.|.::||.: ||:|.:.:|::..:|||||:||||||:|::..   ..:.:.||.:|:.||||.:
  Fly    90 DGCKFLRNQK-HPIIKLFYKIYQGSSNINHTCPYDHDIIVDHLWTGNIESDFLKYIPMINGDYAV 153

  Fly   154 RVKVAFDKEYRTSIKIYAKRTD 175
            ....:.|...|..:.:|.:.|:
  Fly   154 YSNWSTDNIMRAYLNLYFRVTE 175

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 34/84 (40%)
CG33689NP_001027132.2 DUF1091 73..153 CDD:284008 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
55.010

Return to query results.
Submit another query.