DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33137

DIOPT Version :10

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_788343.3 Gene:CG33137 / 36449 FlyBaseID:FBgn0053137 Length:193 Species:Drosophila melanogaster


Alignment Length:154 Identity:39/154 - (25%)
Similarity:71/154 - (46%) Gaps:17/154 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LWSIFVAGD----FQLQNVICESFDNAITNFSRCEMKFI--RRGVAAF--YMVWKLYNVPIKSVD 70
            ::.||...:    ::|:|:.|.:......|.| |.::.|  .:.||..  |::..|||:.|:   
  Fly     1 MYDIFQLSEPNIVYKLKNIECSTVPGFSANAS-CHIRAINWNKAVAEMDVYLLRPLYNITIR--- 61

  Fly    71 INVALYKK--SNGYRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINE 133
              ..:.||  ||.::|||.:..::.|..:......|...::.|:....||.||||||...|:...
  Fly    62 --FQILKKDYSNKFQPFLVDVVINMCDALSRRSFIPYGLIILKIARTFSNFNHSCPYRGHLMARG 124

  Fly   134 FIYKKNDLKDLPIPNGDYMIRVKV 157
            ....::.|.:: .|.|.|...:.:
  Fly   125 AYLNESYLPNV-FPLGFYKFNITI 147

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:461928 23/83 (28%)
CG33137NP_788343.3 DM8 73..164 CDD:214778 19/76 (25%)

Return to query results.
Submit another query.