DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33453

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:164 Identity:45/164 - (27%)
Similarity:85/164 - (51%) Gaps:18/164 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LLWSIFVAGDFQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNV------PIKSVDI 71
            |:.|:..|.:.:|.||:|||.:.:...|..|.:|...|...:.       |:      |..:|.:
  Fly    17 LISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSL-------NINATFLHPTNNVSL 74

  Fly    72 NVALYKKSNGYRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINEFIY 136
            .:.:.|:.:||:||||:.|:|.|.::|. |.:|:|.|.:......|.:||:|||... :::::  
  Fly    75 RLKMVKRLSGYKPFLFDVTIDACQFLRK-RHNPVIKMFYSFIKDYSTLNHTCPYGLQ-VVSDY-- 135

  Fly   137 KKNDLKDLPIPNGDYMIRVKVAFDKEYRTSIKIY 170
             ...:..:|:|:|||.:.:...|..:.:..:.||
  Fly   136 -HTAVFPVPLPSGDYGVLLDFIFYAKKQFHVNIY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 26/81 (32%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 24/79 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472520
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.