DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33454

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_995887.1 Gene:CG33454 / 2768850 FlyBaseID:FBgn0053454 Length:173 Species:Drosophila melanogaster


Alignment Length:156 Identity:51/156 - (32%)
Similarity:97/156 - (62%) Gaps:7/156 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MARGLVIGICWTLLWSIFV-AGDFQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNV 64
            :|..:::|:...:::.::. :...::.||:|||:|.::|.|..|.:|...|...:.: :...:..
  Fly     2 LANVIILGVFVAVVFLVYSDSAMVKMTNVVCESYDKSLTVFHYCRLKAYSRTKTSLH-INATFLH 65

  Fly    65 PIKSVDINVALYKKSNGYRPFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDL 129
            ||.|:.:...:.|::|||:||||:.|:|.|.::|.|. :|:|.:::.:...||||||||||. .:
  Fly    66 PINSISVRFQMLKRANGYKPFLFDITVDACQFLRKPN-NPVIKIVYNMIKDASNINHSCPYG-TV 128

  Fly   130 IINEFIYKKNDLKDLPIPNGDYMIRV 155
            ::|:|  .:..| .||.|:|||:.|:
  Fly   129 VLNDF--HRISL-PLPFPSGDYLSRL 151

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 34/81 (42%)
CG33454NP_995887.1 DUF1091 72..148 CDD:284008 33/80 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472514
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
65.940

Return to query results.
Submit another query.