DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33700 and CG33483

DIOPT Version :9

Sequence 1:NP_001027121.3 Gene:CG33700 / 3772390 FlyBaseID:FBgn0053700 Length:175 Species:Drosophila melanogaster
Sequence 2:NP_001189327.1 Gene:CG33483 / 2768693 FlyBaseID:FBgn0053483 Length:229 Species:Drosophila melanogaster


Alignment Length:138 Identity:49/138 - (35%)
Similarity:82/138 - (59%) Gaps:5/138 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VAGDFQLQNVICESFDNAITNFSRCEMKFIRRGVAAFYMVWKLYNVPIKSVDINVALYKKSNGYR 83
            :|...:..|:.|.|:|.|..:|..|.:|.:.|......:...|:.|||..|.:|.:|.|:.|||:
  Fly    71 IASLVEFTNIKCTSWDKAFDDFEYCHLKSVNRSFKYLSLKVNLHKVPITKVKVNFSLLKRFNGYK 135

  Fly    84 PFLFNQTLDFCYYMRNPRAHPLIYMMHKVFMQASNINHSCPYDHDLIINE----FIYKKNDLKDL 144
            |||:|.|:|.|..:|:.:.:|:....:.:|...||:||:||:|||||:.:    |:.:|.: .|:
  Fly   136 PFLYNITVDACKALRHSKYNPIFSFFYGLFKHHSNMNHTCPFDHDLIVEKLPTNFMNQKVN-GDI 199

  Fly   145 PIPNGDYM 152
            ..|:|||:
  Fly   200 KFPHGDYL 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33700NP_001027121.3 DUF1091 71..153 CDD:284008 34/86 (40%)
CG33483NP_001189327.1 DUF1091 123..208 CDD:284008 34/86 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45472154
Domainoid 1 1.000 52 1.000 Domainoid score I18610
eggNOG 1 0.900 - - E1_2FJG4
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000262
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X90
76.840

Return to query results.
Submit another query.