DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33758 and CG34303

DIOPT Version :10

Sequence 1:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001356898.1 Gene:CG34303 / 5740723 FlyBaseID:FBgn0085332 Length:181 Species:Drosophila melanogaster


Alignment Length:171 Identity:53/171 - (30%)
Similarity:92/171 - (53%) Gaps:4/171 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LALLFFTLLVLTSTEVEAKFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFI 66
            |.:..|.:.|::......||.||.|.....:.|:..||::|||.|..|.|::...|.:.:|::.|
  Fly     9 LCIFCFNIFVISKVHGSYKFNSLACEVMAPELGKMKLCEIKAIDRKHNMINLSAFLNKTISEVEI 73

  Fly    67 RLEFFKR-ANGWRPFLYNFTANLCDFLA-RNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLEC 129
            ..:..|| ..||.||.|:...::|.|.. |....|..:.|::::||...|::||:  :|...:..
  Fly    74 HFKMVKRERGGWHPFFYDIRIDVCQFFKNRRGFFISNLIYSFIKPYTNVNHTCPY--MEGTEMRL 136

  Fly   130 KDFELDINNLRNRFPIETGEYALQLTFIAKNKAALTINGSI 170
            .::..|.:.:..:||::.|.|.||.|:..|.:|||.:|||:
  Fly   137 WNWSPDEDAVLAKFPVDHGTYGLQTTWYVKKEAALKVNGSV 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 24/87 (28%)
CG34303NP_001356898.1 DUF1091 73..157 CDD:461928 23/85 (27%)

Return to query results.
Submit another query.