DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33758 and CG14518

DIOPT Version :10

Sequence 1:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_651653.2 Gene:CG14518 / 43421 FlyBaseID:FBgn0039621 Length:179 Species:Drosophila melanogaster


Alignment Length:148 Identity:45/148 - (30%)
Similarity:80/148 - (54%) Gaps:6/148 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFIRLEFFKRANGWRPFLYNF 84
            |..:..|..:::.:.||.||:|:|:||.:..::|...|..||..:.::....|||||::|:||:.
  Fly    26 KMTNAVCETYNKSWVEFGLCRLRAVSRNKVCLNVDANLLHPVHDVIVKARLLKRANGYKPWLYSV 90

  Fly    85 TANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLECKDFELDINNLRNRFPIETGE 149
            :.:.|.|:.|.||.::.|.:...:.|...|::||:..::    :.|:|.|....|..  ||.|||
  Fly    91 SFDGCQFIRRRNNALIRIVWELFKEYSTINHTCPYVGLQ----QVKNFYLRSEKLPT--PIPTGE 149

  Fly   150 YALQLTFIAKNKAALTIN 167
            |.|.:.::...|.....|
  Fly   150 YLLMIDWVFNKKPQAATN 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 28/85 (33%)
CG14518NP_651653.2 DM8 83..173 CDD:214778 26/91 (29%)

Return to query results.
Submit another query.