DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33758 and CG14455

DIOPT Version :9

Sequence 1:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_649402.2 Gene:CG14455 / 40480 FlyBaseID:FBgn0037175 Length:194 Species:Drosophila melanogaster


Alignment Length:180 Identity:37/180 - (20%)
Similarity:72/180 - (40%) Gaps:30/180 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 LVLTSTEVEAKFKSLHCAA-FDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFIRLEF-FK 72
            ::|||.:.||..|.|.... ...|.||             :::|:..|..|.:..:.:.::| .:
  Fly    31 VILTSIDFEANDKFLDLKVDLQNDSGE-------------SNLSIDIKTHQDIEDVQLVVDFGLE 82

  Fly    73 RANGWRPFLYNFTANLCDFL-ARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLECKDFELDI 136
            ...|....|.|.|.|.|..: .||::.::...|..|..:......||   |.:......::.:|.
  Fly    83 TDKGNYSTLINRTLNFCKLMKQRNSDPLVRAIYEDLLKHGTLFKECP---IRSGTYSLTNYNVDE 144

  Fly   137 NNLRNRFPIETGEYALQLTFIAKNKAAL----TINGSIE----YNNYREY 178
            ..|.:..|.....:.::   |:.:|..:    ||.|.|:    ::|.:.:
  Fly   145 EMLPSFLPEAKFRFGMK---ISTDKGGMIVRSTIFGRIDKSKGFDNLKRF 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 17/87 (20%)
CG14455NP_649402.2 DM8 87..179 CDD:214778 20/97 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.