DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33758 and CG12849

DIOPT Version :10

Sequence 1:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_611969.2 Gene:CG12849 / 37971 FlyBaseID:FBgn0035068 Length:172 Species:Drosophila melanogaster


Alignment Length:168 Identity:44/168 - (26%)
Similarity:72/168 - (42%) Gaps:23/168 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MLALLFFTLLVLTSTEVEA--KFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKL-KQPVS 62
            |..|..|.|:.::...:..  :|.::.|...|:.|.:|..|.||:::|....:|::.|: :.||.
  Fly     1 MSGLWTFLLIFMSPMAIRGHFEFNNVVCLVRDRMFMDFEYCYLKSVNRTYKYLSLKTKMFRLPVD 65

  Fly    63 KIFIRLEFFKRANGWRPFLYN--FTANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENE 125
            ....|.:...|.|  |..|||  |..:.|.|:....:||....|....||...|::||:.     
  Fly    66 NCETRFQLRMREN--RRVLYNFDFKVDSCKFMRDRKHVIANWVYQTFGPYSNLNHTCPYD----- 123

  Fly   126 LLECKDFELD------INNLRNRFPIETGEYALQLTFI 157
                .|..||      :|.|.... |..|.|.:..|::
  Fly   124 ----HDIVLDKLPVQHLNKLVQSI-IPDGRYMMNSTWM 156

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 26/93 (28%)
CG12849NP_611969.2 DM8 80..172 CDD:214778 23/87 (26%)

Return to query results.
Submit another query.