DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33758 and CG33626

DIOPT Version :9

Sequence 1:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027405.2 Gene:CG33626 / 3772257 FlyBaseID:FBgn0053626 Length:167 Species:Drosophila melanogaster


Alignment Length:161 Identity:32/161 - (19%)
Similarity:74/161 - (45%) Gaps:24/161 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 EAKFKSLHCAAFDQDFG----EFLLCKLKAISRLRNSISVQYKLKQPVS--KIFIRLEF-FKRAN 75
            ||| :.|....||...|    :.:.|::....  |:.::|:.||...:.  |::|::.. ||...
  Fly    13 EAK-RRLRWDCFDCQMGPHYADQMTCQIGGTR--RSLLNVELKLLTELDQIKVYIKISTRFKSTT 74

  Fly    76 GWRPFLYNFTANLCDFLARNNNVIMGIGYAYLRPYLVKNYSCPFKVIENELLECKDFELDINN-- 138
            .:|.| ::.|.:.|..:   ::::.|...:.:...:||:.:.|.|...|:      ..:..:|  
  Fly    75 LYRKF-FDITFDGCRVI---SDMVQGTMVSNMFNAVVKSSNQPRKCPVNK------GTIYYHNIS 129

  Fly   139 LRNRFP--IETGEYALQLTFIAKNKAALTIN 167
            :.:..|  :.:.:..:|:.|.|:.:..|.::
  Fly   130 IEDALPMFVPSAQLFIQIDFYARRQLYLNVS 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33758NP_001027397.1 DUF1091 66..152 CDD:284008 15/90 (17%)
CG33626NP_001027405.2 DUF1091 62..140 CDD:284008 15/87 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.