DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33758 and CG33768

DIOPT Version :10

Sequence 1:NP_001027397.1 Gene:CG33758 / 3772381 FlyBaseID:FBgn0053758 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027142.2 Gene:CG33768 / 3771840 FlyBaseID:FBgn0053768 Length:175 Species:Drosophila melanogaster


Alignment Length:112 Identity:23/112 - (20%)
Similarity:44/112 - (39%) Gaps:46/112 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 KFKSLHCAAFDQDFGEFLLCKLKAISRLRNSISVQYKLKQPVSKIFIRLEFFKRANGWRPFLYNF 84
            ||:||..|  |.|:     |:|  :|.|::|:                   |:|   |       
  Fly    76 KFQSLVQA--DTDY-----CEL--LSTLKDSL-------------------FRR---W------- 102

  Fly    85 TANLCDFLARNNNVI----MGIGYAYLRPYLVKNYSCPFKVIENELL 127
                ...:::|:|.:    :..|:.||:.:.|:....|..::..:.|
  Fly   103 ----IKSVSKNSNFMENCPVPAGHYYLKGWHVEMGLVPSYLLSGDYL 145

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33758NP_001027397.1 DUF1091 66..152 CDD:461928 11/66 (17%)
CG33768NP_001027142.2 DM8 76..167 CDD:214778 23/112 (21%)

Return to query results.
Submit another query.