DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG14456

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001137998.1 Gene:CG14456 / 40481 FlyBaseID:FBgn0037176 Length:213 Species:Drosophila melanogaster


Alignment Length:157 Identity:32/157 - (20%)
Similarity:58/157 - (36%) Gaps:30/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 MSLICLIIVPIPTNKILLLESQC----------GNFNRSYFSNFTMFVK------NSQMNMEFFL 58
            |.|...::||:       |.:.|          ..|....|.:...||.      ||..::.|.:
  Fly     1 MLLYTAVLVPV-------LMAMCHGSLAEKMMRPKFKDIKFWSDEKFVSHKVVYDNSDPHLNFSM 58

  Fly    59 -LRVLVPGVTMDIEFFISMQNSYGFQKIFQYTLDMCSLLAQRRNNMFKKWFATFF-DSGNFKKYC 121
             :...:..|.:.:|..|:.:....:......||::|.:|.....:...::...|. :.||..:.|
  Fly    59 EVHQELHDVDIHVEVRITNKQDPYYNTNLNTTLNVCRILGFANKSPVGRFVHGFIREFGNIVETC 123

  Fly   122 PVEPNFY-----YLKNYNYNTLFIPKF 143
            |:....|     :||.....:.||.||
  Fly   124 PIAKGRYHWHRIHLKRKLQGSYFINKF 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 18/82 (22%)
CG14456NP_001137998.1 DM8 82..189 CDD:214778 16/69 (23%)

Return to query results.
Submit another query.