DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33919

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027393.1 Gene:CG33919 / 3772720 FlyBaseID:FBgn0053919 Length:191 Species:Drosophila melanogaster


Alignment Length:195 Identity:40/195 - (20%)
Similarity:73/195 - (37%) Gaps:51/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVVLSISMSLICLIIVPIPTNKIL--LLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPG 65
            |:||.:.:.  |..|..:...:::  |.:.:| ..||:..||.:..||....|:..         
  Fly     2 KLVLVVLLG--CCFIGQLTNTQLVYKLKKIEC-LVNRTRVSNVSCHVKAINWNLAV--------- 54

  Fly    66 VTMDIEFFISMQNSYGFQKIF------QY-------TLDMCSLLAQRRN---------NMFKKWF 108
            |.||....:.:.|.....::|      ||       .:.:|.:: :|||         .:||:: 
  Fly    55 VNMDCFMIVPLHNPIIRMQVFTKDYSNQYKPFLVDVKIRICEVI-ERRNFIPYGVIMWKLFKRY- 117

  Fly   109 ATFFDSGNFKKYCPVEPNFYYLKNYNYNTLFIPKFLYAGKYRVKF---DMNQLRK--IDGVRYFL 168
                  .|....||...:......: .:|..:|.| ..|.|:|..   |.|....  :..:::||
  Fly   118 ------TNVNHSCPFSGHLIARDGF-LDTSLLPPF-PQGFYQVSLVVTDTNSTSTDYVGTMKFFL 174

  Fly   169  168
              Fly   175  174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 20/104 (19%)
CG33919NP_001027393.1 DUF1091 70..152 CDD:284008 17/91 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447835
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.