DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33795

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027129.2 Gene:CG33795 / 3772625 FlyBaseID:FBgn0053795 Length:178 Species:Drosophila melanogaster


Alignment Length:155 Identity:34/155 - (21%)
Similarity:58/155 - (37%) Gaps:29/155 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 TNKILLLESQCGNFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMDIEF---FISMQNSYGFQ 83
            ||.|      |.:.|:|:.:.....:|....|...|.....:...|.|:..   |:..:|.|. .
  Fly    29 TNVI------CESRNQSWVTINECRLKAVNRNRTVFNFNATIHHPTNDVVIDYRFLKRENGYK-P 86

  Fly    84 KIFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPVEPNFY--------YLKNYNYNTLFI 140
            .:::..:|.|..|.:..:.:.|..:..|....|....||    ||        ||:..      |
  Fly    87 WLYKKNIDGCRFLRKPYDMLTKMIYMVFKPFSNINHTCP----FYGDILIRGMYLRTE------I 141

  Fly   141 PKFLY-AGKYRVKFDMNQLRKIDGV 164
            ....| :|||.::.:.:..:||..|
  Fly   142 KAMPYPSGKYMLQINWSFYKKIQVV 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 21/94 (22%)
CG33795NP_001027129.2 DUF1091 77..153 CDD:461928 20/86 (23%)

Return to query results.
Submit another query.