DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33914

DIOPT Version :10

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027394.2 Gene:CG33914 / 3772464 FlyBaseID:FBgn0053914 Length:189 Species:Drosophila melanogaster


Alignment Length:168 Identity:40/168 - (23%)
Similarity:57/168 - (33%) Gaps:47/168 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LICLIIVPIPTNKILLLESQCGNFNRSYFSNFTMFVKNSQM-------------NMEFFLLR--V 61
            |:||          |.|....|.|.|  |:|.|...|:..|             |.....||  :
  Fly    12 LLCL----------LFLTELHGVFMR--FTNVTCESKDLSMSIVEYCAVTTLSKNKNSISLRYAM 64

  Fly    62 LVPGVTMDIEFFISMQNSYGFQKI--------FQYT--LDMCSLLAQRRNNMFKKWFATFFDSGN 116
            |.|..| :||.:..:. :.|.:.|        |.:|  ||:|.......|::.:..|.......|
  Fly    65 LKPMFT-NIEIYFQLM-TRGSESIHAASNWQPFLHTMKLDLCRFWKNHHNHLARMVFEFIDGHTN 127

  Fly   117 FKKYCPVEPNFYYLKNYNYNT--------LFIPKFLYA 146
            ....||.....|...:...||        :.:||..||
  Fly   128 MNHTCPYTKEKYISIDDLTNTEVSAKIRGVPMPKGFYA 165

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:461928 21/97 (22%)
CG33914NP_001027394.2 DUF1091 88..166 CDD:461928 17/78 (22%)

Return to query results.
Submit another query.