DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33773

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_001027213.1 Gene:CG33773 / 3772436 FlyBaseID:FBgn0053773 Length:179 Species:Drosophila melanogaster


Alignment Length:91 Identity:19/91 - (20%)
Similarity:40/91 - (43%) Gaps:15/91 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 NFNRSYFSNFTMFVKNSQMNMEFFLLRVLVPGVTMDIEFFISMQNSYGFQK-IFQYTLDMCSLLA 97
            :.||||          ..::.::.|.::.:|.:.::   ||..:...|::. ::..|.|.|..:.
  Fly    49 SINRSY----------KYVSGKYKLNQIPLPRMKVN---FIMWKRLNGYRPFLYNITADACKFVE 100

  Fly    98 QRRNNMFKKW-FATFFDSGNFKKYCP 122
            ..::|...|: |.:|....|....||
  Fly   101 NPKSNPVLKYIFDSFSAYSNMNHSCP 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 13/57 (23%)
CG33773NP_001027213.1 DUF1091 73..158 CDD:284008 13/57 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447818
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.