DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG13193

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_610699.1 Gene:CG13193 / 36256 FlyBaseID:FBgn0033650 Length:189 Species:Drosophila melanogaster


Alignment Length:173 Identity:43/173 - (24%)
Similarity:74/173 - (42%) Gaps:11/173 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ISMSLICLIIVPIPTNKILLLESQCGNFNRSYFSNFT-MFVKNSQMNMEFFLLRVLVPGVTMDIE 71
            |.:.:..|...|...:|...:..:|   ::.|.|:.. ......::|::..|.|.|..|:...|.
  Fly    20 IQIQISALRFGPTLRSKFTNISVEC---SKDYCSSIRGWLTAKGELNLDIHLNRTLKNGLRTTIT 81

  Fly    72 FFISMQNSYGFQKIFQYTLDMCSLLAQ-RRNNMFKKWFATFFDSGNFKKYCPVEPNFYYLKNYNY 135
            ....:.....:|.:|.|.:|.|..|.: .::::.|.|....|..||....||::|..|.::|:..
  Fly    82 LLQLIDGKDRYQTLFSYDMDTCKTLRELLQSSLMKVWLRNVFKYGNLADRCPIQPASYDVRNFQL 146

  Fly   136 NTLFIPKFLYAGKYRVKFDMNQLRKIDG-----VRYFLVGCAF 173
            ....||.:|.||.||: .|.|...|..|     |..|::...|
  Fly   147 ENHSIPGYLPAGFYRL-HDTNYYGKPKGRQRRPVATFILDIKF 188

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 23/83 (28%)
CG13193NP_610699.1 DM8 91..183 CDD:214778 28/92 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45463888
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2FAPI
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 49 1.000 Inparanoid score I7668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006712
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.980

Return to query results.
Submit another query.