DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG33766 and CG33453

DIOPT Version :9

Sequence 1:NP_001027140.1 Gene:CG33766 / 3772380 FlyBaseID:FBgn0053766 Length:178 Species:Drosophila melanogaster
Sequence 2:NP_995888.1 Gene:CG33453 / 2768851 FlyBaseID:FBgn0053453 Length:175 Species:Drosophila melanogaster


Alignment Length:162 Identity:36/162 - (22%)
Similarity:65/162 - (40%) Gaps:19/162 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 AKVVL-SISMSLICLIIVPIPTNKILLLESQCGNFNRS----YFSNFTMFVKN-SQMNMEFFLLR 60
            :.|:| .:.::.:.||........|.|....|.:.|:|    ::.....:.:| :.:|:....|.
  Fly     3 SNVILPGVFLAALFLISSVSEAPNIKLTNVVCESINKSWAVFHYCRLKAYSRNKTSLNINATFLH 67

  Fly    61 VLVPGVTMDIEFFISMQNSYGFQK--IFQYTLDMCSLLAQRRNNMFKKWFATFFDSGNFKKYCPV 123
                 .|.::...:.|.......|  :|..|:|.|..|.:|.|.:.|.:::...|.......|| 
  Fly    68 -----PTNNVSLRLKMVKRLSGYKPFLFDVTIDACQFLRKRHNPVIKMFYSFIKDYSTLNHTCP- 126

  Fly   124 EPNFYYLKNY-NYNTLFIPKFLYAGKYRVKFD 154
                |.|:.. :|:|...|..|.:|.|.|..|
  Fly   127 ----YGLQVVSDYHTAVFPVPLPSGDYGVLLD 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG33766NP_001027140.1 DUF1091 68..151 CDD:284008 21/85 (25%)
CG33453NP_995888.1 DUF1091 74..149 CDD:284008 20/79 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447845
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR20898
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.