DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Prss36

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_017167884.1 Gene:Prss36 / 77613 MGIID:1924863 Length:863 Species:Mus musculus


Alignment Length:275 Identity:92/275 - (33%)
Similarity:133/275 - (48%) Gaps:58/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELELRR---SPRIVGG---HPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPS 79
            |:|:..|   |.|||||   ||. .|  |..|::.:.|...|||||:.|..||:||||       
Mouse    35 EDLDCGRPEPSSRIVGGSDAHPG-TW--PWQVSLHQGGGHICGGSLIAPSWVLSAAHC------- 89

  Fly    80 DFVVRGGVTYLSDM---------------RNSRYVRKILMPSAYSRTTLDHDVALLQLKQP--LQ 127
             ||..|.:....::               .:.|.|..||:|..||...|..|:|||:|..|  |.
Mouse    90 -FVTNGTLEPADELSVLLGVHSQDGPLEGAHMRSVATILIPDNYSTVELGADLALLRLASPAKLG 153

  Fly   128 ASIAKPISLAVRSPRP------GSFVRVSGWG-LTDSSSTSLPNQLQSVHVQVMPQRECRDLYR- 184
            .|: :|:.|    ||.      |:....:||| :.::....||..||.|.::::.:..|:.||. 
Mouse   154 PSV-RPVCL----PRASHLFAHGTACWATGWGDVQEAVPLPLPWVLQEVELRLLGEAACQCLYSR 213

  Fly   185 -GYRNIT----SSMFCASVP-GLKDACAGDSGGPVVNSNG---ILVGVVSWGRAHRCAARDSPGV 240
             |..|:|    ..|.||..| |.:|.|.||||||:|..:|   .|.|:.|:|  ..|..|:.|||
Mouse   214 PGPFNLTFQLLPGMLCAGYPAGRRDTCQGDSGGPLVCEDGGRWFLAGITSFG--FGCGRRNRPGV 276

  Fly   241 YSDVSYLSDWIADNI 255
            ::.|:....||.:::
Mouse   277 FTAVAPYESWIREHV 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 86/257 (33%)
Tryp_SPc 31..254 CDD:238113 87/259 (34%)
Prss36XP_017167884.1 Tryp_SPc 48..290 CDD:238113 87/259 (34%)
Tryp_SPc 331..532 CDD:389826
Tryp_SPc 607..789 CDD:389826
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.