DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Prss55

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_008769022.1 Gene:Prss55 / 683415 RGDID:1586875 Length:321 Species:Rattus norvegicus


Alignment Length:271 Identity:85/271 - (31%)
Similarity:144/271 - (53%) Gaps:33/271 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MLLPLMFWMLWIRESVAEELELRRSP---------RIVGGHPSDVWHQPHMVNIRRRGNFECGGS 59
            |:||.:  :|.:..::...:|....|         ||:||..::|...|..|:|:...:..||||
  Rat     1 MILPSI--LLLVVHTLEANVECGVRPLYDSRIGHSRIIGGQEAEVGEFPWQVSIQENDHHFCGGS 63

  Fly    60 LVTPRCVLTAAHCL--NDGNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQL 122
            :::...:||.|||.  .:.:|::..||.|...|:.......|..|:....:.|.::|:|:|||.|
  Rat    64 ILSEWWILTVAHCFYSQELSPTELTVRVGTNDLTTSPMELQVTNIIRHKDFKRHSMDNDIALLLL 128

  Fly   123 KQPL---QASIAKPISLAVRSPRPGSFVR--VSGWGLTDSS-STSLPNQLQSVHVQVMPQRECRD 181
            ..||   :.::  ||.:.:: |.|.|:..  |:|||.|:|: ..|:...|..|.:::...:||..
  Rat   129 ANPLTFNEQTV--PICMPLQ-PTPPSWQECWVAGWGTTNSADKESMNMDLMKVPMRITDWKECLQ 190

  Fly   182 LYRGYRNITSSMFCASVPGLK-DACAGDSGGPVV---NSNG--ILVGVVSWGRAHRCAARDSPGV 240
            |   :.::|::|.|||..... |||.||||||:|   .|:|  ..||::|||::  |..:.|||:
  Rat   191 L---FPSLTTNMLCASYGNESFDACQGDSGGPLVCNQESDGRWYQVGIISWGKS--CGQKGSPGI 250

  Fly   241 YSDVSYLSDWI 251
            |:.::....||
  Rat   251 YTVLANYILWI 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 77/234 (33%)
Tryp_SPc 31..254 CDD:238113 78/235 (33%)
Prss55XP_008769022.1 Tryp_SPc 35..264 CDD:238113 78/235 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.