DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG34458

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001097340.1 Gene:CG34458 / 5740868 FlyBaseID:FBgn0085487 Length:257 Species:Drosophila melanogaster


Alignment Length:256 Identity:76/256 - (29%)
Similarity:121/256 - (47%) Gaps:19/256 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MLLPLMFWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLT 68
            :||.:.|        |..::::....||:||..:.....||.|:::..|...|||||::...::|
  Fly    13 LLLAVTF--------VHSDMDVAEESRIIGGQFAAPGQFPHQVSLQLNGRHHCGGSLISDTMIVT 69

  Fly    69 AAHCLNDGNPSDFVVRGGVTYLSDMRNSRY-VRKILMPSAYSRTTLDHDVALLQLKQPL-QASIA 131
            ||||....||.......|...||......: :.:.::...|:..:.|.|::|::|..|: .....
  Fly    70 AAHCTMGQNPGQMKAIVGTNDLSAGNGQTFNIAQFIIHPRYNPQSQDFDMSLIKLSSPVPMGGAV 134

  Fly   132 KPISLAVRSPR--PGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMF 194
            :.|.||.....  ..:...:||:|.. :.:..|||:|:...||:..:..|..  :....:|..|.
  Fly   135 QTIQLADSDSNYAADTMAMISGFGAI-NQNLQLPNRLKFAQVQLWSRDYCNS--QNIPGLTDRMV 196

  Fly   195 CASVP-GLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADN 254
            ||..| |...:|.|||||| :..:|.|.||||||  ..|.|:..|.:|:.|..|..||..|
  Fly   197 CAGHPSGQVSSCQGDSGGP-LTVDGKLFGVVSWG--FGCGAKGRPAMYTYVGALRSWIKQN 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 69/225 (31%)
Tryp_SPc 31..254 CDD:238113 70/227 (31%)
CG34458NP_001097340.1 Tryp_SPc 31..251 CDD:214473 69/225 (31%)
Tryp_SPc 32..254 CDD:238113 70/227 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.