DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and KLK10

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001070968.1 Gene:KLK10 / 5655 HGNCID:6358 Length:276 Species:Homo sapiens


Alignment Length:262 Identity:78/262 - (29%)
Similarity:122/262 - (46%) Gaps:27/262 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPLMFWMLWIRE-SVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLT 68
            ||||:...||..| ::..:.:.|..|...|. |.....||..|::....:|.|.|.||....|||
Human    20 LLPLLMAQLWAAEAALLPQNDTRLDPEAYGS-PCARGSQPWQVSLFNGLSFHCAGVLVDQSWVLT 83

  Fly    69 AAHCLND------GNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYS-------RTTLDHDVALL 120
            ||||.|.      |:....:::|     ..:|  |..|.::.|..:.       |.|.:||:.||
Human    84 AAHCGNKPLWARVGDDHLLLLQG-----EQLR--RTTRSVVHPKYHQGSGPILPRRTDEHDLMLL 141

  Fly   121 QLKQP-LQASIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYR 184
            :|.:| :.....:.:.|..|..:||...:|:|||.|.:........|....:.::..:||...|.
Human   142 KLARPVVLGPRVRALQLPYRCAQPGDQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYP 206

  Fly   185 GYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSD 249
            |.  :|::|.||.:...:|.|..|||||:| .:..|.|::||| .:.|.:...|.||:.:.....
Human   207 GV--VTNNMICAGLDRGQDPCQSDSGGPLV-CDETLQGILSWG-VYPCGSAQHPAVYTQICKYMS 267

  Fly   250 WI 251
            ||
Human   268 WI 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 67/234 (29%)
Tryp_SPc 31..254 CDD:238113 69/235 (29%)
KLK10NP_001070968.1 Tryp_SPc 49..272 CDD:238113 69/233 (30%)
Tryp_SPc 49..269 CDD:214473 67/231 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.