DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and PRSS3

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011516267.1 Gene:PRSS3 / 5646 HGNCID:9486 Length:333 Species:Homo sapiens


Alignment Length:275 Identity:96/275 - (34%)
Similarity:142/275 - (51%) Gaps:40/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 PLMFWMLW-----IRESVAEELELRR------------SPRIVGGHPSDVWHQPHMVNIRRRGNF 54
            |:..|::|     .|...::.|.:|.            ..:||||:..:....|:.|::....:|
Human    69 PVFNWLIWKILERERHRGSDYLPIRNQNELGVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHF 133

  Fly    55 ECGGSLVTPRCVLTAAHCLND------GNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTL 113
             |||||::.:.|::||||...      |..:..|:.|...:::       ..||:....|:|.||
Human   134 -CGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFIN-------AAKIIRHPKYNRDTL 190

  Fly   114 DHDVALLQLKQP--LQASIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQ 176
            |:|:.|::|..|  :.|.:: .|||....|..|:...:||||.|.|.....|::|:.:...|:.|
Human   191 DNDIMLIKLSSPAVINARVS-TISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQ 254

  Fly   177 RECRDLYRGYRNITSSMFCAS-VPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGV 240
            .||:..|.|  .||:||||.. :.|.||:|..||||||| .||.|.||||||  |.||.::.|||
Human   255 AECKASYPG--KITNSMFCVGFLEGGKDSCQRDSGGPVV-CNGQLQGVVSWG--HGCAWKNRPGV 314

  Fly   241 YSDVSYLSDWIADNI 255
            |:.|....|||.|.|
Human   315 YTKVYNYVDWIKDTI 329

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 86/229 (38%)
Tryp_SPc 31..254 CDD:238113 88/231 (38%)
PRSS3XP_011516267.1 Tryp_SPc 109..325 CDD:214473 86/229 (38%)
Tryp_SPc 110..328 CDD:238113 88/231 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.