DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Prss53

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:277 Identity:73/277 - (26%)
Similarity:120/277 - (43%) Gaps:70/277 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDF----VVRGGVTY--LSDMRNSRY 98
            |  |...::||:|...|.||||....|||||||......::.    ||.|.:..  ||.......
  Rat    48 W--PWQASVRRQGVHICSGSLVADTWVLTAAHCFEKMATAELSSWSVVLGSLKQEGLSPGAEEVG 110

  Fly    99 VRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPRP------GSFVRVSGWG---- 153
            |..:.:|.||:..:...|:|||||..|:       :...:..|:|      |:....:||.    
  Rat   111 VAALQLPKAYNHYSQGSDLALLQLTHPI-------VHTTLCLPQPTHHFPFGASCWATGWDQNTS 168

  Fly   154 ------------------LT------------DSSSTSLP--NQLQSVHVQVMPQRECRDLY-RG 185
                              ||            ||:.:.||  ..|:::.::::.:..|..|| |.
  Rat   169 DGKYCPRHKSRESQTGSVLTVLALCSHCVSELDSTLSPLPVSRTLRNLRLRLISRPTCNCLYNRL 233

  Fly   186 YRNI-----TSSMFCASV-PGLKDACAGDSGGPVV----NSNGILVGVVSWGRAHRCAARDSPGV 240
            ::.:     .|.|.|... ||::..|.|||||||:    :.:.:.||::|:  ...||..|:|.:
  Rat   234 HQRLLANPARSGMLCGGAQPGVQGPCQGDSGGPVMCREPDGHWVQVGIISF--TSNCAQEDTPVL 296

  Fly   241 YSDVSYLSDWIADNIHR 257
            .:|::..|.|:..::.|
  Rat   297 LTDMAAHSSWLQAHVDR 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 71/269 (26%)
Tryp_SPc 31..254 CDD:238113 72/272 (26%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113 72/272 (26%)
Tryp_SPc 341..561 CDD:238113
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.