DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Prss36

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_038942639.1 Gene:Prss36 / 497040 RGDID:1593186 Length:874 Species:Rattus norvegicus


Alignment Length:270 Identity:98/270 - (36%)
Similarity:140/270 - (51%) Gaps:48/270 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELELRR---SPRIVGG---HPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHC-LNDG-- 76
            |:|:..|   |.|||||   ||. .|  |..|::...|...|||||:.|..||:|||| :.:|  
  Rat    46 EDLDCGRPEPSSRIVGGSDAHPG-TW--PWQVSLHHGGGHICGGSLIAPSWVLSAAHCFVTNGTL 107

  Fly    77 NPSD--FVVRG-----GVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQP--LQASIAK 132
            .|:|  .|:.|     |....:.||:   |..||:|..|||..|..|:|||:|..|  |..|: |
  Rat   108 EPADEWSVLLGVHSQDGPLEGAHMRS---VATILVPDNYSRVELGADLALLRLASPAKLGPSV-K 168

  Fly   133 PISLAVRSPRP------GSFVRVSGWG-LTDSSSTSLPNQLQSVHVQVMPQRECRDLYR--GYRN 188
            |:.|    ||.      |:....:||| :.:|....:|..||.|.::::.:..|:.||.  |..|
  Rat   169 PVCL----PRASHLFAHGTACWATGWGDVQESDPLPVPWVLQEVELKLLGETACQCLYSRPGPFN 229

  Fly   189 IT----SSMFCASVP-GLKDACAGDSGGPVVNSNG---ILVGVVSWGRAHRCAARDSPGVYSDVS 245
            :|    ..|.||..| |.:|.|.||||||:|..:|   .|.|:.|:|  ..|..|:.|||::.|:
  Rat   230 LTLQLLPGMLCAGYPEGRRDTCQGDSGGPLVCEDGGRWFLAGITSFG--FGCGRRNRPGVFTAVA 292

  Fly   246 YLSDWIADNI 255
            :...||.:::
  Rat   293 HYESWIREHV 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 92/252 (37%)
Tryp_SPc 31..254 CDD:238113 93/254 (37%)
Prss36XP_038942639.1 Tryp_SPc 59..301 CDD:238113 93/254 (37%)
Tryp_SPc 338..532 CDD:419748
Tryp_SPc 607..802 CDD:419748
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.