DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and epsilonTry

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:224 Identity:86/224 - (38%)
Similarity:130/224 - (58%) Gaps:6/224 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMR 94
            |||||:.:.:...|:.|:::|.|:..||||:.:...|:||||||......|..:|.|.||.....
  Fly    30 RIVGGYETSIDAHPYQVSLQRYGSHFCGGSIYSHDIVITAAHCLQSIEAKDLKIRVGSTYWRSGG 94

  Fly    95 NSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSFVRVSGWGLTDSS 158
            :...||.......|:..|:.:|:|:::::..|. .|..:.|.:|..:||.|:...|||||.|:|.
  Fly    95 SVHSVRSFRNHEGYNSRTMVNDIAIIRIESDLSFRSSIREIRIADSNPREGATAVVSGWGTTESG 159

  Fly   159 STSLPNQLQSVHVQVMPQRECRDLYRGY-RNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVG 222
            .:::|:.|.:|.::::....||....|| :.|..:|.||..|. ||||.||||||:| |...|||
  Fly   160 GSTIPDHLLAVDLEIIDVSRCRSDEFGYGKKIKDTMLCAYAPH-KDACQGDSGGPLV-SGDRLVG 222

  Fly   223 VVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            |||||  :.|.....||||:||::..:||
  Fly   223 VVSWG--YGCGDVRYPGVYADVAHFHEWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 84/222 (38%)
Tryp_SPc 31..254 CDD:238113 85/223 (38%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 84/222 (38%)
Tryp_SPc 31..252 CDD:238113 85/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.