DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and deltaTry

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_523694.2 Gene:deltaTry / 48343 FlyBaseID:FBgn0010358 Length:253 Species:Drosophila melanogaster


Alignment Length:239 Identity:94/239 - (39%)
Similarity:138/239 - (57%) Gaps:6/239 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFV 82
            :|.|.|..:...|||||..:.:...|..::::|.|:..||||:.:...::||||||...:.|...
  Fly    18 TVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSSNVIVTAAHCLQSVSASVLQ 82

  Fly    83 VRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSF 146
            :|.|.:|.|....:..|........|:..|:.:|:|::::...|. :|..|.|.||..:|..|:.
  Fly    83 IRAGSSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKINGALTFSSTIKAIGLASSNPANGAA 147

  Fly   147 VRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGY-RNITSSMFCASVPGLKDACAGDSG 210
            ..|||||.....|:|:|:|||.|:|.::.|.:|.....|| ..|.|:|.||:..| ||||.||||
  Fly   148 ASVSGWGTLSYGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRSTMICAAASG-KDACQGDSG 211

  Fly   211 GPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADN 254
            ||:| |.|:||||||||  :.||..:.||||:||:.|..|:..|
  Fly   212 GPLV-SGGVLVGVVSWG--YGCAYSNYPGVYADVAALRSWVISN 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 89/222 (40%)
Tryp_SPc 31..254 CDD:238113 89/224 (40%)
deltaTryNP_523694.2 Tryp_SPc 30..249 CDD:214473 89/222 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.