DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and alphaTry

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:236 Identity:97/236 - (41%)
Similarity:138/236 - (58%) Gaps:6/236 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 SVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFV 82
            :|.|.|..:...|||||..:.:...|..::::|.|:..||||:.:...::||||||...:.|...
  Fly    18 TVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHSCGGSIYSANIIVTAAHCLQSVSASVLQ 82

  Fly    83 VRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSF 146
            ||.|.||.|.......|........|:..|:.:|:|:::|...|. :|..|.||||..:|..|:.
  Fly    83 VRAGSTYWSSGGVVAKVSSFKNHEGYNANTMVNDIAVIRLSSSLSFSSSIKAISLATYNPANGAS 147

  Fly   147 VRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGY-RNITSSMFCASVPGLKDACAGDSG 210
            ..|||||...|.|:|:|:|||.|:|.::.|.:|.....|| ..|.::|.||:..| ||||.||||
  Fly   148 AAVSGWGTQSSGSSSIPSQLQYVNVNIVSQSQCASSTYGYGSQIRNTMICAAASG-KDACQGDSG 211

  Fly   211 GPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            ||:| |.|:||||||||  :.||..:.||||:||:.|..|:
  Fly   212 GPLV-SGGVLVGVVSWG--YGCAYSNYPGVYADVAVLRSWV 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 93/222 (42%)
Tryp_SPc 31..254 CDD:238113 93/223 (42%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 93/222 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.