DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and zgc:92590

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001007055.1 Gene:zgc:92590 / 474322 ZFINID:ZDB-GENE-041024-15 Length:247 Species:Danio rerio


Alignment Length:238 Identity:81/238 - (34%)
Similarity:121/238 - (50%) Gaps:25/238 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIR-RRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDM 93
            :|:||:......||..:.:. ..|...||.||:..|..::||||        ::|...:|.....
Zfish    20 KIIGGYECSPNSQPWQIYLTYDNGQRWCGASLINDRWAVSAAHC--------YLVANRLTVHLGE 76

  Fly    94 RNSRY---------VRKILMPSAYSRTTLDHDVALLQLKQP-LQASIAKPISLAVRSPRPGSFVR 148
            .|...         ..|::....|:..|||:|..|::||:| :.....:|:.|.......|....
Zfish    77 HNVAVEEGTEQRIKAEKVIPHPKYNDYTLDNDFMLIKLKEPAVFNQYVQPVPLTTSCSSEGEQCL 141

  Fly   149 VSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCAS-VPGLKDACAGDSGGP 212
            |||||...::....|:.||.:::.|:.:.:|...| |:: ||.:||||. :.|.||||.||||||
Zfish   142 VSGWGNLINTGVVYPDVLQCLNLPVLTRAQCEGAY-GWQ-ITKNMFCAGFMEGGKDACQGDSGGP 204

  Fly   213 VVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255
            |: .||.|.||||||  :.||....||||::|...:||:|..|
Zfish   205 VI-CNGELRGVVSWG--YGCADSGYPGVYTEVCRYTDWVASTI 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 78/232 (34%)
Tryp_SPc 31..254 CDD:238113 80/234 (34%)
zgc:92590NP_001007055.1 Tryp_SPc 20..240 CDD:214473 78/232 (34%)
Tryp_SPc 21..243 CDD:238113 80/234 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.