DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG34130

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001036759.1 Gene:CG34130 / 4379866 FlyBaseID:FBgn0083966 Length:297 Species:Drosophila melanogaster


Alignment Length:232 Identity:47/232 - (20%)
Similarity:94/232 - (40%) Gaps:26/232 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMR 94
            |..|||.     .|.::.|.....|.||.|.::....||:|:|:: .:.|...........||.|
  Fly    48 RTSGGHA-----VPWLLRIVDGPTFVCGASYLSALYALTSANCMH-SHRSQMESLSVELVSSDSR 106

  Fly    95 N----------SRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPRPGSFVRV 149
            .          :..:|.|::...:.......|||:::|...|:.:....::|..........:.|
  Fly   107 QDNQLDSHDPPNALIRNIIVSKDWHWPGTFMDVAVIELTNRLRGNRNNYVTLCTNPLSSYKSLSV 171

  Fly   150 SGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVV 214
            ..:|...:.:      :::..::|:.:..|...|..:. :..::.||........|...:|.| |
  Fly   172 VSYGAGPAEN------VRTEEIEVLNRMICDSAYGNFL-LRETVACAKEFKRSADCMFSAGCP-V 228

  Fly   215 NSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            .:...|.|:|:|..|  |...:.||:::|:..:..:|
  Fly   229 TAGDQLCGIVAWSPA--CKRSNLPGIFTDIHQVKRFI 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 46/230 (20%)
Tryp_SPc 31..254 CDD:238113 46/231 (20%)
CG34130NP_001036759.1 Trypsin 53..263 CDD:278516 43/225 (19%)
Tryp_SPc 53..256 CDD:304450 42/218 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.