DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG7142

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:235 Identity:59/235 - (25%)
Similarity:110/235 - (46%) Gaps:29/235 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 PHMVNIRRRGNFE-----CGGSLVTPRCVLTAAHCLNDGNP-SDFVVRGGVTYLSDMRNS----- 96
            |::|:|:.....:     |.|:::....:|||||||:.... .:.|:..|...:.|.:..     
  Fly    92 PYVVSIQMMTPDQGLVHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQ 156

  Fly    97 -RYVRKILMPSAYSRTTLDHDVALLQLKQPLQ-ASIAKPISLAVRSPRPGSFVRVSGWGLTDSSS 159
             |::...:....|......:|:||:..|:||. .:..:|.:|..:..:|..:..:.|||  :.|.
  Fly   157 MRHIDYYVRHELYLGGVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPEGYGTLYGWG--NVSM 219

  Fly   160 TSLPN---QLQSVHVQVMPQRECRD-LYRGYRNITSSMFCAS-VPGLKDACAGDSGGPVV----- 214
            |::||   :||..::.::....|.. |.|....:..:..|.. :.|....|..|||||::     
  Fly   220 TAVPNYPHRLQEANMPILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCE 284

  Fly   215 ---NSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
               ....|::|:||||:. .|..:::|.|:..||..::||
  Fly   285 EHFEQANIVIGIVSWGKM-PCGQKNAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 57/233 (24%)
Tryp_SPc 31..254 CDD:238113 59/235 (25%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 59/235 (25%)
Tryp_SPc 84..323 CDD:214473 57/233 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455653
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.