DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG31266

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001138068.1 Gene:CG31266 / 42071 FlyBaseID:FBgn0051266 Length:282 Species:Drosophila melanogaster


Alignment Length:239 Identity:63/239 - (26%)
Similarity:112/239 - (46%) Gaps:14/239 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 LELRRSP------RIVGGHPSDVWHQPHMVNIRRRGNFE-CGGSLVTPRCVLTAAHCLNDGNPSD 80
            :|..||.      |::||..:...:.|.:.:|:...::. ||..::....|||||.|:....|.:
  Fly    38 IERHRSTEAVPQGRVIGGTTAAEGNWPWIASIQNAYSYHLCGAIILDETWVLTAASCVAGLRPLN 102

  Fly    81 FVVRGGVTYLSDMRNSRY-VRKILMPSAYSRTTLDHDVALLQLKQPLQAS-IAKPISLA-VRSPR 142
            .:|..|.....|:....| |.:|.:...:.:....:|:|||||...::.: :.|.|:|| :....
  Fly   103 LLVVTGTVDWWDLYAPYYTVSQIHVHCNFDKPLYHNDIALLQLSSKIEFNDVTKNITLADIDELE 167

  Fly   143 PGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAG 207
            .|..:..:|||.:::..| ....||......:|...||:..:...::.....|..:...:.||.|
  Fly   168 EGDKLTFAGWGSSEAMGT-YGRYLQEASGTYLPVDACREKLQNQDDVDLGHVCVQMDAGQGACHG 231

  Fly   208 DSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            |:|||:::....|||:.:||..   ..|..|.||:..::..|||
  Fly   232 DTGGPLIDEQQRLVGIGNWGVP---CGRGYPDVYARTAFYHDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 58/224 (26%)
Tryp_SPc 31..254 CDD:238113 59/225 (26%)
CG31266NP_001138068.1 Tryp_SPc 51..272 CDD:214473 58/224 (26%)
Tryp_SPc 52..275 CDD:238113 59/225 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439379
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.850

Return to query results.
Submit another query.