DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG10405

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001036717.1 Gene:CG10405 / 41996 FlyBaseID:FBgn0038431 Length:268 Species:Drosophila melanogaster


Alignment Length:274 Identity:91/274 - (33%)
Similarity:141/274 - (51%) Gaps:35/274 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MQGMLLPLMFWM----LWIRESVAEELELRRSP--RIVGGHPSDVWHQPHMVNIRRRGNFECGGS 59
            ||....|:.|.:    |.|.|:...|..:.|.|  |||.|..:.....|:.:::||:....||.|
  Fly     1 MQKCRAPIPFLLIAGILVILEASRTEAAVPRQPDSRIVNGREATEGQFPYQLSLRRQTVHICGAS 65

  Fly    60 LVTPRCVLTAAHCLNDGN---PSDFVVRGGVTYLSDMRNS----RYVRKILMPSAYSRTTLDHDV 117
            :::....:|||||: ||:   |.:|.:|.|    |.||.|    :.|:.|....||.|..::.||
  Fly    66 ILSSNWAITAAHCI-DGHEQQPREFTLRQG----SIMRTSGGTVQPVKAIYKHPAYDRADMNFDV 125

  Fly   118 ALLQLKQPLQASIAKPIS--LAVRSPRPGSFVR------VSGWGLTDSSSTSLPNQLQSVHVQVM 174
            |||   :....:::.|:.  ..:|.|..|..:.      |||||...:|:..|.:.|:|..|..:
  Fly   126 ALL---RTADGALSLPLGKVAPIRLPTVGEAISESMPAVVSGWGHMSTSNPVLSSVLKSTTVLTV 187

  Fly   175 PQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPG 239
            .|.:|.:..|.:..:|.:||||:... .|||.|||||| :::.|.|:|:||||..  ||....||
  Fly   188 NQEKCHNDLRHHGGVTEAMFCAAARN-TDACQGDSGGP-ISAQGTLIGIVSWGVG--CADPYYPG 248

  Fly   240 VYSDVSY--LSDWI 251
            ||:.:::  :..||
  Fly   249 VYTRLAHPTIRRWI 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 79/237 (33%)
Tryp_SPc 31..254 CDD:238113 80/238 (34%)
CG10405NP_001036717.1 Tryp_SPc 36..262 CDD:214473 79/237 (33%)
Tryp_SPc 37..263 CDD:238113 80/238 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.