DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Sems

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:247 Identity:88/247 - (35%)
Similarity:137/247 - (55%) Gaps:15/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 EELELRR----------SPRIVGGH-PSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLN 74
            |.::|::          ..|::||. .::.....::|.:|...||.|||:|:....|||||||..
  Fly    24 ETIDLKKLAKIVLPPAYQTRVIGGRVTTNAKLGGYLVAMRYFNNFICGGTLIHELIVLTAAHCFE 88

  Fly    75 D-GNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAV 138
            | .....:.|.||::.||:....|.|::.:..:.:...|::.|||::.|.:|:.......:||..
  Fly    89 DRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRPMVGKNIGTLSLCS 153

  Fly   139 RSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKD 203
            .:..||..:.|||||:|:.......:.|::|.|.|:.:|.||:.||...:|:.|||||||.|.||
  Fly   154 TALTPGQTMDVSGWGMTNPDDEGPGHMLRTVSVPVIEKRICREAYRESVSISDSMFCASVLGKKD 218

  Fly   204 ACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255
            ||..|||||:|....: .|:||:|..  ||:|..||||:||.|:..:|...|
  Fly   219 ACTYDSGGPLVYEKQV-CGIVSFGIG--CASRRYPGVYTDVHYVKPFIVKGI 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 84/222 (38%)
Tryp_SPc 31..254 CDD:238113 84/224 (38%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 84/222 (38%)
Tryp_SPc 44..265 CDD:238113 84/223 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.