DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG32277

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_728835.1 Gene:CG32277 / 38393 FlyBaseID:FBgn0052277 Length:261 Species:Drosophila melanogaster


Alignment Length:263 Identity:88/263 - (33%)
Similarity:137/263 - (52%) Gaps:16/263 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMFWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHC 72
            |:..:..:.:.....|...|..:|.||..:.|.....:||:||.|.|.|||.:::|.||||||||
  Fly     4 LLIGLALLHQLEGSSLFTLRQGKIFGGKTTLVKDHSFLVNLRRGGKFRCGGVIISPNCVLTAAHC 68

  Fly    73 LNDG---NPSDFVVRGGVTYLSDMRNSRYVRKI----LMPSAYSRTTLDHDVALLQLKQPLQ-AS 129
            | :|   ...|..|......|.|.....:||..    |.|:..::..||.|:|:::|.:|.. |.
  Fly    69 L-EGRYQQVRDLTVHAQQQCLGDDMPPEHVRSAWYVGLSPNYCAQRGLDSDLAVIRLSRPFDIAG 132

  Fly   130 IAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQREC-RDLYRGYRNITSSM 193
            .|..:.:......|.|.:.|.|||..:....:....||..:|:::..||| :.:..|::.:|::|
  Fly   133 NASLVKIDYNDLPPHSNLTVLGWGAINEQGHNWNQCLQEANVKLISHRECIKSVGSGWQKVTNNM 197

  Fly   194 FCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVS--YLSDWIADNIH 256
            |||.....:|||.||||||.:.: |..||:||||  :.|.: ..||||:.:|  .::.|:.|.|.
  Fly   198 FCALGKNARDACQGDSGGPAIYA-GRSVGIVSWG--YGCGS-GYPGVYTRLSSPSITYWLKDFIE 258

  Fly   257 RYC 259
            |:|
  Fly   259 RHC 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/231 (35%)
Tryp_SPc 31..254 CDD:238113 81/233 (35%)
CG32277NP_728835.1 Tryp_SPc 26..246 CDD:214473 79/224 (35%)
Tryp_SPc 27..246 CDD:238113 79/223 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.