DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG32271

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_728833.1 Gene:CG32271 / 38392 FlyBaseID:FBgn0052271 Length:248 Species:Drosophila melanogaster


Alignment Length:247 Identity:106/247 - (42%)
Similarity:146/247 - (59%) Gaps:14/247 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLPLMFWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTA 69
            |:||    .|...:.|       :.|||||.|.|:...|::||:|..|||.||||||||:.|:||
  Fly    10 LIPL----CWAASNEA-------NSRIVGGVPVDIASVPYLVNLRIGGNFMCGGSLVTPQHVVTA 63

  Fly    70 AHCLNDGNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPI 134
            |||:.....|..:|..|||.|::......|.|:..|.||:..||..|||:|:||.|:.......|
  Fly    64 AHCVKGIGASRILVVAGVTRLTETGVRSGVDKVYTPKAYNTRTLTSDVAVLKLKAPISGPKVSTI 128

  Fly   135 SLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVP 199
            .|...|.:.|..::|||||.....:.::..|::||.|.::|::.|...|:....||::|||||||
  Fly   129 ELCNTSFKAGDLIKVSGWGQITERNKAVSMQVRSVDVALIPRKACMSQYKLRGTITNTMFCASVP 193

  Fly   200 GLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            |:||||.||||||.| ..|.|.|:||||..  ||.:.|||||::|..:..:|
  Fly   194 GVKDACEGDSGGPAV-YQGQLCGIVSWGVG--CARKSSPGVYTNVKTVRSFI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 100/220 (45%)
Tryp_SPc 31..254 CDD:238113 100/221 (45%)
CG32271NP_728833.1 Tryp_SPc 24..242 CDD:214473 100/220 (45%)
Tryp_SPc 25..244 CDD:238113 100/221 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455629
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.