DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG3650

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_611971.1 Gene:CG3650 / 37974 FlyBaseID:FBgn0035070 Length:249 Species:Drosophila melanogaster


Alignment Length:230 Identity:93/230 - (40%)
Similarity:136/230 - (59%) Gaps:5/230 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 PRIVGGHPSDVWH-QPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSD 92
            ||||||..:.:.. ...:||:|..|.|.|||||||...|:||||||.....|...|:|||:.||.
  Fly    24 PRIVGGTTTTLSAVGGFVVNLRYDGTFYCGGSLVTSSHVVTAAHCLKGYQASRITVQGGVSKLSQ 88

  Fly    93 MRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPRPGSFVRVSGWGLTDS 157
            ....|.|.:..:|:.:|.::|:.||.:::|:..|..|....|.|......||:::||||||.|..
  Fly    89 SGVVRRVARYFIPNGFSSSSLNWDVGVIRLQSALTGSGITTIPLCQVQWNPGNYMRVSGWGTTRY 153

  Fly   158 SSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVG 222
            .::|..|||::|.:|::.::.|:..|:|...:|:|.|||...| ||:|:|||||.|:..|. |.|
  Fly   154 GNSSPSNQLRTVRIQLIRKKVCQRAYQGRDTLTASTFCARTGG-KDSCSGDSGGGVIFKNQ-LCG 216

  Fly   223 VVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHR 257
            :||||..  ||....||||:.|..:..:|..:|.:
  Fly   217 IVSWGLG--CANAQYPGVYTSVHRVRSFILRSIKK 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 90/221 (41%)
Tryp_SPc 31..254 CDD:238113 90/223 (40%)
CG3650NP_611971.1 Tryp_SPc 25..243 CDD:214473 90/221 (41%)
Tryp_SPc 26..243 CDD:238113 89/220 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455630
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.