DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG32269

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001261363.1 Gene:CG32269 / 3772569 FlyBaseID:FBgn0052269 Length:332 Species:Drosophila melanogaster


Alignment Length:254 Identity:100/254 - (39%)
Similarity:141/254 - (55%) Gaps:20/254 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 RESVAEELELRR-------------SPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVL 67
            |:..|.:|..:|             ..|||||..:.:...|::|.:||..|. |.|||:|.:.||
  Fly    81 RQGTARKLSAKRVNQNKKAATSSKIQSRIVGGTSTTISTTPYIVQLRRGSNL-CSGSLITEQWVL 144

  Fly    68 TAAHCLNDGNPSDFVVRGGVTYLSDMRN-SRYVRKILMPSAYSRTTLDHDVALLQLKQPLQASIA 131
            |||||:...:.|||.||||.|.|..... :|.|..|.:...::...::.|.|||:|.|.|..:..
  Fly   145 TAAHCVKGYSASDFTVRGGTTTLDGSDGVTRSVSSIHVAPKFTSKKMNMDAALLKLNQSLTGTNI 209

  Fly   132 KPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCA 196
            ..||:....|:.||.||::|||:|...||:....||:..::|:.|::||..|||...||..|.||
  Fly   210 GTISMGNYRPKAGSRVRIAGWGVTKEGSTTASKTLQTAQIRVVRQQKCRKDYRGQATITKYMLCA 274

  Fly   197 SVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNI 255
            ...| ||:|:|||||||..:| .|:|:||:|  :.||....||||:.|..:..| |.||
  Fly   275 RAAG-KDSCSGDSGGPVTRNN-TLLGIVSFG--YGCARAGYPGVYTAVVAIRQW-ATNI 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 92/221 (42%)
Tryp_SPc 31..254 CDD:238113 93/223 (42%)
CG32269NP_001261363.1 Tryp_SPc 108..324 CDD:214473 92/220 (42%)
Tryp_SPc 121..324 CDD:238113 87/207 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455624
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0003271
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.