DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG32833

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:238 Identity:70/238 - (29%)
Similarity:116/238 - (48%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 VGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFV-VRGGVTYLSDMRN 95
            :||||.::...|.:.:|..:...:|.|::.....::||..|: ||..:..: ||.|.|..||...
  Fly    39 LGGHPVNITTAPWIASISIKQKAKCDGAIYKLSHIVTAGKCV-DGFLNKVIRVRVGSTTRSDGVI 102

  Fly    96 SRYVRKILMPSAYSRTTLDHDVALLQLKQPLQAS-IAKPISLAVRSPRPGSFVRVSGWG------ 153
            ...|..|.:...::..|:.|:||:|:|.:||:|| ..:||.||.:.|..|:.|..:||.      
  Fly   103 EVAVCNITVHEKFTGQTVFHNVAILKLCEPLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWWA 167

  Fly   154 ------LTDSSSTSLPNQLQSVHVQVMPQRECRDLYR----GYRNITSSMFCASVPGLKDACAGD 208
                  |.|.:     .:||...|:::...:|.||:.    ..:|.|..:||.. ...|:||:..
  Fly   168 MYWKKCLDDEA-----YKLQKAEVKLLGPSQCTDLWARNNWSKKNFTDDLFCTE-KFAKEACSLA 226

  Fly   209 SGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWI 251
            .|.|||: ||.|||:::.|     ...:.|.||.::....||:
  Fly   227 MGSPVVH-NGKLVGIITKG-----GCSEYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 69/236 (29%)
Tryp_SPc 31..254 CDD:238113 70/238 (29%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 70/237 (30%)
Tryp_SPc 40..262 CDD:214473 68/234 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.