DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and etaTry

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster


Alignment Length:241 Identity:88/241 - (36%)
Similarity:132/241 - (54%) Gaps:30/241 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFE------CGGSLVTPRCVLTAAHCLNDGNPSDFVV----- 83
            |||||..:..::..::|.:|||.:..      |||.::....:.|||||:.:....:|:|     
  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAENFLVVAGDD 91

  Fly    84 -RGGVTYLSDMRNSRYVR--KILMPSAYSRTTLDHDVALLQLKQPL---QASIAKPISLAVRSPR 142
             |||:       |...||  |::....|:.:|:|:|:||:.:..||   ..|..:.|.:|...|.
  Fly    92 SRGGM-------NGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPA 149

  Fly   143 PGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASV-PGLKDACA 206
            .|....:||||.|..:..| .:|||.|.|.::...:|::.|. :|.|:..|.||.: .|.||||.
  Fly   150 VGVQATISGWGYTKENGLS-SDQLQQVKVPIVDSEKCQEAYY-WRPISEGMLCAGLSEGGKDACQ 212

  Fly   207 GDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIA 252
            ||||||:|.:|. |.|:||||..  ||..:.||||::|:|..||||
  Fly   213 GDSGGPLVVANK-LAGIVSWGEG--CARPNYPGVYANVAYYKDWIA 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 85/238 (36%)
Tryp_SPc 31..254 CDD:238113 87/240 (36%)
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 85/238 (36%)
Tryp_SPc 28..257 CDD:238113 87/240 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455649
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.