DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and zetaTry

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_523691.1 Gene:zetaTry / 36216 FlyBaseID:FBgn0011556 Length:280 Species:Drosophila melanogaster


Alignment Length:273 Identity:96/273 - (35%)
Similarity:141/273 - (51%) Gaps:43/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 QGMLLPLMFWMLWIRESVAEELELRRSP--RIVGGHPSDVWHQPHMVNIRRRG--------NFEC 56
            ||  |||:           |:|:.:..|  |||||:.:|:...|:.:::|.:|        ...|
  Fly    21 QG--LPLL-----------EDLDEKSVPDGRIVGGYATDIAQVPYQISLRYKGITTPENPFRHRC 72

  Fly    57 GGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYL--SD--MRNSRYVRKILMPSA-YSRTTLDHD 116
            |||:.....::|||||:.....|.:.|..|..:.  ||  :.|   |::|:|... ||....::|
  Fly    73 GGSIFNETTIVTAAHCVIGTVASQYKVVAGTNFQTGSDGVITN---VKEIVMHEGYYSGAAYNND 134

  Fly   117 VALLQLKQPLQAS--IAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQREC 179
            :|:|.:..||..:  ..|.|.||:..|..|:..:|||||.|.....| .|||.:|.|.::....|
  Fly   135 IAILFVDPPLPLNNFTIKAIKLALEQPIEGTVSKVSGWGTTSPGGYS-SNQLLAVDVPIVSNELC 198

  Fly   180 RDLYRGYRN----ITSSMFCASVPGL--KDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSP 238
            ...|..:.:    |||:|.||...|:  .|||.||||||:...:. |.||||||.:  ||..:.|
  Fly   199 DQDYEDFGDETYRITSAMLCAGKRGVGGADACQGDSGGPLAVRDE-LYGVVSWGNS--CALPNYP 260

  Fly   239 GVYSDVSYLSDWI 251
            |||::|:||..||
  Fly   261 GVYANVAYLRPWI 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 86/241 (36%)
Tryp_SPc 31..254 CDD:238113 87/242 (36%)
zetaTryNP_523691.1 Tryp_SPc 38..273 CDD:214473 86/241 (36%)
Tryp_SPc 39..276 CDD:238113 87/242 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.