DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Send2

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:252 Identity:87/252 - (34%)
Similarity:127/252 - (50%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 FWMLWIRESVAEELELRRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLN 74
            |.:|....|::....:|...||:||.|..:...|..|:|:|.|...||||:.:...::|||||:.
  Fly     6 FLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGKHLCGGSIYSADIIITAAHCVQ 70

  Fly    75 DGNPSDFVVRGGVTYLSDMRNSRYVRKILMPSAYSRT--TLDHDVALLQLKQPLQ-ASIAKPISL 136
            .   ..:.||.|    |.::||   ...::..|..||  .|.:|:|:::|.:||: .:..:||.|
  Fly    71 G---QGYQVRAG----SALKNS---NGSVVDVAAIRTHEGLGNDIAIVRLSKPLEFTNQVQPIPL 125

  Fly   137 AVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITS-SMFCASVPG 200
            |..:|.|||...|||||  .||..|.|..||.|::.:.        :..|..:|. |..||...|
  Fly   126 AKTNPPPGSIAFVSGWG--SSSYYSHPIDLQGVNLYIQ--------WPYYCGLTEPSRICAGSFG 180

  Fly   201 LKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDS--PGVYSDVSYLSDWIADNI 255
             :.||.||||||:|.... ||||||.|      .:|.  ..:|:.|.|..:||.:.|
  Fly   181 -RAACKGDSGGPLVFDQQ-LVGVVSGG------TKDCTYSSIYTSVPYFREWILNAI 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 80/226 (35%)
Tryp_SPc 31..254 CDD:238113 81/228 (36%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 80/226 (35%)
Tryp_SPc 27..225 CDD:238113 79/225 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.