DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Phae2

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:241 Identity:66/241 - (27%)
Similarity:113/241 - (46%) Gaps:25/241 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNP--SDFVVRGGVTY--L 90
            |:|||..:.....|::|:::..|...|..:::....::||||||.:.|.  ...:|.|.:..  .
  Fly    31 RVVGGKAAAANSAPYIVSMQYGGTHYCAANIINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGT 95

  Fly    91 SDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQPL--QASIAKPISLAVRSPRPGSFVRVSGWG 153
            :.....|.:...::...|:..|:.:|:.|:......  .|::| |:.|.....||.....:.|||
  Fly    96 ASTTQKRQITHYVINDLYTGGTVPYDIGLIYTPTAFTWTAAVA-PVKLPSSGVRPTGKADLFGWG 159

  Fly   154 LTD-SSSTSLPNQLQSV-HVQVMPQREC--------RDLYRGYRNITSSMFCASVPGLKDACAGD 208
            .|. ::|.|.|..||.. ::.::....|        :|::      |:::....:.|....|..|
  Fly   160 STSKTNSPSYPKTLQEAKNIPIISLDSCAAALGSKGQDVH------TTNLCTGPLTGGTSFCTSD 218

  Fly   209 SGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADN 254
            ||||:|..| :|:|:||||:. .|...:||.||..||....|||.|
  Fly   219 SGGPLVQGN-VLIGIVSWGKL-PCGQPNSPSVYVQVSSFITWIAAN 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 62/236 (26%)
Tryp_SPc 31..254 CDD:238113 64/238 (27%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 62/236 (26%)
Tryp_SPc 32..262 CDD:238113 64/238 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.