DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Try29F

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_001285772.1 Gene:Try29F / 34226 FlyBaseID:FBgn0015316 Length:267 Species:Drosophila melanogaster


Alignment Length:247 Identity:94/247 - (38%)
Similarity:132/247 - (53%) Gaps:41/247 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RRSPRIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYL 90
            |...|||||..:::...|:.|:::|..:| |||||:....|||||||          ..|....|
  Fly    37 RLDGRIVGGQVANIKDIPYQVSLQRSYHF-CGGSLIAQGWVLTAAHC----------TEGSAILL 90

  Fly    91 SDMR--NSRY--------VRKILMPSAYSRTTLDHDVALLQL-----KQPLQASIAKP---ISLA 137
            |.:|  :||.        ::::.....:...|:|.|.:||:|     |...||.:..|   ..:|
  Fly    91 SKVRIGSSRTSVGGQLVGIKRVHRHPKFDAYTIDFDFSLLELEEYSAKNVTQAFVGLPEQDADIA 155

  Fly   138 VRSPRPGSFVRVSGWGLTDSS-STSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVP-G 200
            ..:|     |.|||||.|.|: .||.  .|:||.|..:.|.:|.:.|..:.:||..|.||.:| |
  Fly   156 DGTP-----VLVSGWGNTQSAQETSA--VLRSVTVPKVSQTQCTEAYGNFGSITDRMLCAGLPEG 213

  Fly   201 LKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIA 252
            .||||.||||||:. ::|:|.||||||  :.||..:.|||||.||.:.|||:
  Fly   214 GKDACQGDSGGPLA-ADGVLWGVVSWG--YGCARPNYPGVYSRVSAVRDWIS 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 91/240 (38%)
Tryp_SPc 31..254 CDD:238113 92/242 (38%)
Try29FNP_001285772.1 Tryp_SPc 41..261 CDD:214473 91/240 (38%)
Tryp_SPc 42..264 CDD:238113 92/242 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.