DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and PRSS53

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:XP_011544118.1 Gene:PRSS53 / 339105 HGNCID:34407 Length:623 Species:Homo sapiens


Alignment Length:279 Identity:68/279 - (24%)
Similarity:113/279 - (40%) Gaps:78/279 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 WHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDF----VVRGGVTY--LSDMRNSRY 98
            |  |...::||:|...|.||||....|||||||......::.    ||.|.:..  ||.......
Human    48 W--PWQASVRRQGAHICSGSLVADTWVLTAAHCFEKAAATELNSWSVVLGSLQREGLSPGAEEVG 110

  Fly    99 VRKILMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPRP------GSFVRVSGWGLTDS 157
            |..:.:|.||:..:...|:|||||..|   :...|:.|    |:|      |:....:||....|
Human   111 VAALQLPRAYNHYSQGSDLALLQLAHP---TTHTPLCL----PQPAHRFPFGASCWATGWDQDTS 168

  Fly   158 --------------------------------------------SSTSLPNQLQSVHVQVMPQRE 178
                                                        |.:..|..|:::.::::.:..
Human   169 DGKCWPRLKLGEALCLPSVTVSAPNCPGFQSPLLPRSQTLAPAPSLSPAPGTLRNLRLRLISRPT 233

  Fly   179 CRDLYR--GYRNITS----SMFCAS-VPGLKDACAGDSGGPVV----NSNGILVGVVSWGRAHRC 232
            |..:|.  ..|::::    .|.|.. .||::..|.|||||||:    :.:.:..|::|:  |..|
Human   234 CNCIYNQLHQRHLSNPARPGMLCGGPQPGVQGPCQGDSGGPVLCLEPDGHWVQAGIISF--ASSC 296

  Fly   233 AARDSPGVYSDVSYLSDWI 251
            |..|:|.:.::.:..|.|:
Human   297 AQEDAPVLLTNTAAHSSWL 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 67/277 (24%)
Tryp_SPc 31..254 CDD:238113 68/279 (24%)
PRSS53XP_011544118.1 Tryp_SPc 42..316 CDD:238113 68/279 (24%)
Tryp_SPc 43..314 CDD:214473 67/276 (24%)
Tryp_SPc 359..>512 CDD:304450
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.