DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG4271

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608665.1 Gene:CG4271 / 33410 FlyBaseID:FBgn0031409 Length:242 Species:Drosophila melanogaster


Alignment Length:220 Identity:61/220 - (27%)
Similarity:102/220 - (46%) Gaps:10/220 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 DVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCLNDGNPSDFVVRGGVTYLSDMRNSRYVRKI 102
            |.|  ..:.::...|..||||:::..|.|||||.|:.:.......||.|...:  .|..|.:|..
  Fly    28 DFW--TFLASVWVSGYHECGGAVIDSRIVLTAAQCVKNKPVKRITVRVGTPDI--YRGGRIIRVT 88

  Fly   103 LMPSAYSRTTLDHDVALLQLKQPLQASIAKPISLAVRSPRPGSFVRVSGWGLTDSSSTSLPNQLQ 167
            .:....:....|:|:|||.|::|:.:.....|.||.:.|....:...:|||.....|..:..:||
  Fly    89 ALVVHENYKNWDNDIALLWLEKPVLSVRVTKIPLATKEPSENEYPSNAGWGEKLLESYVVTRKLQ 153

  Fly   168 SVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRC 232
            :...::.|:..|.:  .....:...:.||.... .|.|.||.|||:|.:|.: ||:...|  |.|
  Fly   154 NGVTKIRPRSMCAE--ELVEPVGEELLCAFYTE-NDICPGDYGGPLVLANKV-VGIAVQG--HGC 212

  Fly   233 AARDSPGVYSDVSYLSDWIADNIHR 257
            .....|.:|::|.:..:||.:|..:
  Fly   213 GFAVLPSLYTNVFHYLEWIEENAEK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 58/212 (27%)
Tryp_SPc 31..254 CDD:238113 60/215 (28%)
CG4271NP_608665.1 Tryp_SPc 19..234 CDD:238113 60/215 (28%)
Tryp_SPc 19..231 CDD:214473 58/212 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455650
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.