DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and Ser12

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:257 Identity:88/257 - (34%)
Similarity:131/257 - (50%) Gaps:21/257 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LMFWMLWIRESVAEELELRRSP-RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAH 71
            |:.|::.:.....  :....|| |||||||..:...|....:.....:.||..:.:.:.::||||
  Fly     2 LLHWLVLVASVTL--ISAGSSPERIVGGHPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAH 64

  Fly    72 CLNDGNPSD--FVVRGGVTYLSDMRNSRYVRKILMPSAY-SRTTLDHDVALLQLKQPL--QASIA 131
            |:.  .|.|  :.||.|..:.:.......|..|.....| |.|.|.:|:|:::|...|  .|.: 
  Fly    65 CVE--RPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVDTLIFNAEV- 126

  Fly   132 KPISLAVRSPRPGSFVRVSGWGLTDSSSTSL-PNQLQSVHVQVMPQRECRDLYRGYRNITSSMFC 195
            :||.||..:|..|:...|||||  :.....| |..|....|:::....|:   |.|:.||.:|.|
  Fly   127 RPIQLADSAPAAGTEASVSGWG--EIGILWLQPTSLLKTSVKILDPNVCK---RSYQYITKTMIC 186

  Fly   196 ASVPGLKDACAGDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADNIHR 257
            |:.. |||:|.||||||:| |.|.|||:||:|..  ||....||||::|:.|..||.:.|.:
  Fly   187 AAAL-LKDSCHGDSGGPLV-SGGQLVGIVSYGIG--CANPFFPGVYANVAELKPWILNAIEQ 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 81/226 (36%)
Tryp_SPc 31..254 CDD:238113 82/228 (36%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 81/226 (36%)
Tryp_SPc 24..238 CDD:238113 80/225 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.