DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG11911

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608518.1 Gene:CG11911 / 33206 FlyBaseID:FBgn0031249 Length:277 Species:Drosophila melanogaster


Alignment Length:236 Identity:65/236 - (27%)
Similarity:110/236 - (46%) Gaps:17/236 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IVGGHPSDVWHQPHMVNIRR---RGNFECGGSLVTPRCVLTAAHCLNDGNPSDFV----VRGGVT 88
            ::.|..::....|::|::..   :.:..|||:|:....::|||||:::......:    .|..|.
  Fly    37 VINGTEAEPHSAPYIVSLATNYLKHSHICGGTLINKDWIVTAAHCISEPVGMSIIAGLHTRAEVD 101

  Fly    89 YLSDMRNSRYVRKILMPSAYSRTTLDHDVALLQLKQP-LQASIAKPISLAVRSPRPGSFVRVSGW 152
            .|:..|...:.|   :...|:.....:|:|||.:.:. :.....:|.:|..|.........:.||
  Fly   102 ELTQQRQVDFGR---VHEKYTGGVGPYDIALLHVNESFIFNEWVQPATLPSREQVHEGETHLYGW 163

  Fly   153 GLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFC-ASVPGLKDACAGDSGGPVV-- 214
            |...|...|....||:|..|::...||::.......|..|..| :|:...|.||.||||||:|  
  Fly   164 GQPKSYIFSGAKTLQTVTTQILNYEECKEELPESAPIAESNICSSSLQQSKSACNGDSGGPLVVE 228

  Fly   215 --NSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIAD 253
              |:...|:|:||||.. .|...:.|.:|:.||...|||.:
  Fly   229 FTNAPSELIGIVSWGYI-PCGLANMPSIYTKVSAYIDWITN 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 63/232 (27%)
Tryp_SPc 31..254 CDD:238113 65/236 (28%)
CG11911NP_608518.1 Tryp_SPc 37..269 CDD:238113 65/236 (28%)
Tryp_SPc 37..266 CDD:214473 63/232 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455647
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.