DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32270 and CG1304

DIOPT Version :9

Sequence 1:NP_728837.1 Gene:CG32270 / 3772375 FlyBaseID:FBgn0052270 Length:259 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:243 Identity:78/243 - (32%)
Similarity:111/243 - (45%) Gaps:35/243 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 RIVGGHPSDVWHQPHMVNIRRRGNFECGGSLVTPRCVLTAAHCL----NDGN-----PSDFVVRG 85
            |:|||..:.....||.|::|..|:..||||:::...|||||||:    ::||     ...|.:|.
  Fly    31 RVVGGEDAVKNQFPHQVSLRNAGSHSCGGSILSRNYVLTAAHCVTNQDSNGNSVPIAAERFTIRA 95

  Fly    86 GVTYLSDMRNSRY-------VRKILMPSAYSRTTLDHDVALLQLKQP--LQASIAKPISLAVRSP 141
            |       .|.|:       |.::::...|....  :|||||:|:.|  |.||| :||.|.....
  Fly    96 G-------SNDRFSGGVLVQVAEVIVHEEYGNFL--NDVALLRLESPLILSASI-QPIDLPTADT 150

  Fly   142 RPGSFVRVSGWGLTDSSSTSLPNQLQSVHVQVMPQRECRDLYRGYRNITSSMFCASVPGLKDACA 206
            .....|.:||||...... .||..||...::.:....|.:|. |:.  ..|..|........||.
  Fly   151 PADVDVIISGWGRIKHQG-DLPRYLQYNTLKSISLERCDELI-GWG--VQSELCLIHEADNGACN 211

  Fly   207 GDSGGPVVNSNGILVGVVSWGRAHRCAARDSPGVYSDVSYLSDWIADN 254
            ||||||.|.:|.: |||.  |..........|..|:.|.|.::||.:|
  Fly   212 GDSGGPAVYNNQV-VGVA--GFVWSACGTSYPDGYARVYYHNEWIKNN 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32270NP_728837.1 Tryp_SPc 30..251 CDD:214473 75/238 (32%)
Tryp_SPc 31..254 CDD:238113 76/240 (32%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 75/238 (32%)
Tryp_SPc 32..256 CDD:238113 76/240 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.